Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Uncharacterized membrane protein sll0875 (sll0875)

This Recombinant Synechocystis sp. Uncharacterized membrane protein sll0875 (sll0875) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein sll0875

UniProt

P73555

Expression Region

1-258

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNSLLSEIWRQSLAFPWLSAVILNSFLLALAAIAPKKLLTPWGYGHAWVLGVIIWAALG WRGYLVVLAYFFVGSAVTRIGQKEKEAAGIAEKRSGQRGPENVWGSALTAALCALAIAFG PEPWQLWLALGYVASFSTKLSDTTASEVGKAYGKNTFLITTLQPVPRGTEGAVSVEGTLA GFAAGLALAVLGYGVGLISFGGIIFSTLAAFIATNLESVIGATLQNKWPWLTNEVVNGIN TFLGAAIAIGIEATAQLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tipin Antibody
orb861565 2 mg

Tipin Antibody

Sign In for Pricing
View Details
FAM90A3 shRNA (h) Lentiviral Particles
sc-77611-V 200 µL

FAM90A3 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
BRCA1 Mouse Monoclonal Antibody [Clone ID: GLK-2]
DM424 1 mL

BRCA1 Mouse Monoclonal Antibody [Clone ID: GLK-2]

Sign In for Pricing
View Details
Ebola virus GP (Zaire Strain) IgM Antibody ELISA Kit, Mouse
VACY-1022-CY167 1 Kit

Ebola virus GP (Zaire Strain) IgM Antibody ELISA Kit, Mouse

Sign In for Pricing
View Details
Rabbit Polyclonal SPDYC Antibody [Alexa Fluor 350]
NBP2-98160AF350 0.1 mL

Rabbit Polyclonal SPDYC Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Selplg sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6134406 1.0 µg DNA

Selplg sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details