Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Uncharacterized membrane protein sll0875 (sll0875)

This Recombinant Synechocystis sp. Uncharacterized membrane protein sll0875 (sll0875) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein sll0875

UniProt

P73555

Expression Region

1-258

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNSLLSEIWRQSLAFPWLSAVILNSFLLALAAIAPKKLLTPWGYGHAWVLGVIIWAALG WRGYLVVLAYFFVGSAVTRIGQKEKEAAGIAEKRSGQRGPENVWGSALTAALCALAIAFG PEPWQLWLALGYVASFSTKLSDTTASEVGKAYGKNTFLITTLQPVPRGTEGAVSVEGTLA GFAAGLALAVLGYGVGLISFGGIIFSTLAAFIATNLESVIGATLQNKWPWLTNEVVNGIN TFLGAAIAIGIEATAQLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plp1 3'UTR GFP Stable Cell Line
TU166569 1.0 mL

Plp1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CCDC150 Antibody
A62890-50UG 50 µg

CCDC150 Antibody

Sign In for Pricing
View Details
DZIP1L (NM_173543) Human Recombinant Protein
PROTQ8IYY4 20 µg

DZIP1L (NM_173543) Human Recombinant Protein

Sign In for Pricing
View Details
Bleximenib oxalate (JNJ-75276617 oxalate) 10mg
A24334-10 10 mg

Bleximenib oxalate (JNJ-75276617 oxalate) 10mg

Sign In for Pricing
View Details
5-Hydroxyoxindole
MBS5785260 Inquire

5-Hydroxyoxindole

Sign In for Pricing
View Details
BAALC Polyclonal Antibody, Cy5 Conjugated
bs-9849R-Cy5 100 µL

BAALC Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details