Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Uncharacterized membrane protein sll0875 (sll0875)

This Recombinant Synechocystis sp. Uncharacterized membrane protein sll0875 (sll0875) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein sll0875

UniProt

P73555

Expression Region

1-258

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNSLLSEIWRQSLAFPWLSAVILNSFLLALAAIAPKKLLTPWGYGHAWVLGVIIWAALG WRGYLVVLAYFFVGSAVTRIGQKEKEAAGIAEKRSGQRGPENVWGSALTAALCALAIAFG PEPWQLWLALGYVASFSTKLSDTTASEVGKAYGKNTFLITTLQPVPRGTEGAVSVEGTLA GFAAGLALAVLGYGVGLISFGGIIFSTLAAFIATNLESVIGATLQNKWPWLTNEVVNGIN TFLGAAIAIGIEATAQLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Hepatobiliary Cancer Cells [RBE]
AFG-ELL-0176 > 1x 10^6 Cells / Vial

Human Hepatobiliary Cancer Cells [RBE]

Sign In for Pricing
View Details
Seryl-tRNA synthetase/SERS/SARS1 Rabbit Polyclonal Antibody (Fluoro647)
orb3118092 100 µg

Seryl-tRNA synthetase/SERS/SARS1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Phospho-Smad3 (S425) (1D9) Mouse Monoclonal Antibody
E28PM3724 100 µL

Phospho-Smad3 (S425) (1D9) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GPNMB Mouse Monoclonal Antibody [Clone ID: LBI2F9]
AMM17964V 100 µL

GPNMB Mouse Monoclonal Antibody [Clone ID: LBI2F9]

Sign In for Pricing
View Details
HAUS3 Polyclonal Antibody
MBS2575539-01 0.06 mL

HAUS3 Polyclonal Antibody

Sign In for Pricing
View Details
HAUS3 Polyclonal Antibody
MBS2575539-02 0.12 mL

HAUS3 Polyclonal Antibody

Sign In for Pricing
View Details