Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum Flagellar biosynthetic protein fliP (fliP)

This Recombinant Pectobacterium carotovorum subsp. carotovorum Flagellar biosynthetic protein fliP (fliP) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein fliP, Flagellar biosynthetic protein mopC

UniProt

P34200

Expression Region

1-258

Origin

Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSALPNYFRITALLRTQRYGLAIGLLFMAPSVWAQLPGIVTQPLPNGGQSWTLSVQTLVL LTSLTFLPAALLMMTSFTRIIIVLSLLRNALGTPTAPPNQVLLGLTLFLTFFVMSPVLNR VYDEAYLPFSQDQISMEVAIERGAEPVREFMLRQTRETDLALFTRLAEIPEIQGPEAVPM RVLLPAFVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPATISLPFKLMLFV LVDGWQLLLGSLAQSFYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-500 1x 500 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF488A conjugate, 0.1mg/mL
BNC882462-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF647 conjugate, 0.1mg/mL
BNC471864-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (E29), CF740 conjugate, 0.1mg/mL
BNC740478-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (E29), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details