Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium vitis Cobalamin synthase (cobS)

This Recombinant Agrobacterium vitis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B9JW08

Expression Region

1-259

Origin

Agrobacterium vitis (strain S4 / ATCC BAA-846) (Rhizobium vitis (strain S4) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLTAFVDDLARSLGFLSRLPIASRFFQNHSGEMSRTPRAFPLAGAVITAPAGLLLALML GLGASSMVAAFAAIGLQVLLTGALHEDGFADTADGLGGANRERALDIMKDSRVGTFGVLA LVFGVGLRVAALASLVNSLSPINVALVMIGIAAVSRALMVWHWHALPPAKPDGVAASLGK PEDNTLYTALFLGLAVAVVTIAPVTSFHPLAVMLVASGAAAFASNRLVSHRLGGQTGDTI GATQQICEITALASIAMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCAT Rabbit Polyclonal Antibody (BF750)
orb2466311 100 µL

LCAT Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Lentiviral mouse Myo18b shRNA (UAS) - Lentiviral mouse Myo18b shRNA (UAS, RFP) (100)
GTR15187404 1 Vial

Lentiviral mouse Myo18b shRNA (UAS) - Lentiviral mouse Myo18b shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
DAB1 Polyclonal Antibody
MBS8566440-01 0.1 mL

DAB1 Polyclonal Antibody

Sign In for Pricing
View Details
DAB1 Polyclonal Antibody
MBS8566440-02 0.1 mL (AF405L)

DAB1 Polyclonal Antibody

Sign In for Pricing
View Details
DAB1 Polyclonal Antibody
MBS8566440-03 0.1 mL (AF405S)

DAB1 Polyclonal Antibody

Sign In for Pricing
View Details
DAB1 Polyclonal Antibody
MBS8566440-04 0.1 mL (AF610)

DAB1 Polyclonal Antibody

Sign In for Pricing
View Details