Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium vitis Cobalamin synthase (cobS)

This Recombinant Agrobacterium vitis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B9JW08

Expression Region

1-259

Origin

Agrobacterium vitis (strain S4 / ATCC BAA-846) (Rhizobium vitis (strain S4) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLTAFVDDLARSLGFLSRLPIASRFFQNHSGEMSRTPRAFPLAGAVITAPAGLLLALML GLGASSMVAAFAAIGLQVLLTGALHEDGFADTADGLGGANRERALDIMKDSRVGTFGVLA LVFGVGLRVAALASLVNSLSPINVALVMIGIAAVSRALMVWHWHALPPAKPDGVAASLGK PEDNTLYTALFLGLAVAVVTIAPVTSFHPLAVMLVASGAAAFASNRLVSHRLGGQTGDTI GATQQICEITALASIAMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF488-Donkey Anti-Mouse IgG (H+L) preadsorbed
RD90836A-01 120 μL

AF488-Donkey Anti-Mouse IgG (H+L) preadsorbed

Sign In for Pricing
View Details
AF488-Donkey Anti-Mouse IgG (H+L) preadsorbed
RD90836A-02 500 µL

AF488-Donkey Anti-Mouse IgG (H+L) preadsorbed

Sign In for Pricing
View Details
AF488-Donkey Anti-Mouse IgG (H+L) preadsorbed
RD90836A-03 1 mL

AF488-Donkey Anti-Mouse IgG (H+L) preadsorbed

Sign In for Pricing
View Details
SR-1F Polyclonal Conjugated Antibody
orb1618494 100 µL

SR-1F Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Lentiviral human TTLL7 sgRNA gene knockout kit - Lentiviral human TTLL7 sgRNA gene knockout kit (plasmid)
GTR15354226 1 Vial

Lentiviral human TTLL7 sgRNA gene knockout kit - Lentiviral human TTLL7 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
HRP2 (HRPII, Histidine-rich protein 2, Malaria Histidine-rich protein 2, Malaria HRP2) (AP)
MBS6260510-01 0.1 mL

HRP2 (HRPII, Histidine-rich protein 2, Malaria Histidine-rich protein 2, Malaria HRP2) (AP)

Sign In for Pricing
View Details