Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Motility protein A (motA)

This Recombinant Motility protein A (motA) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Motility protein A, Chemotaxis protein MotA

UniProt

Q56331

Expression Region

1-259

Origin

Treponema phagedenis

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLASFIGFFGAFAIILMGGILGGSASGFFHLPSVFITVGGSYLTLFLAYPLSYTLGIFK VCARVFKSADFHEKEIVQRLYALAEKSRRTGLLALEEEIQDFDDEFMRTGLRNVVDGIDG EAIRNLMENELSHMEERHNRWISFINAWATLAPGYGMLGTVMGLIGMLMALEDKSSLGQN MAVALVTTLYGSLMANWLLIPMATKLGLQHEAEVKSKEMIIEGVLAIQAGDHPRILAQRL LVYLNPKDKRELEAELIKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBR3 Antibody
8C14950-AAT 50 µg

CBR3 Antibody

Sign In for Pricing
View Details
Recombinant Rat Fas/TNFRSF6/CD95 Protein (Fc Tag)
PDMR100072-01 20 µg

Recombinant Rat Fas/TNFRSF6/CD95 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat Fas/TNFRSF6/CD95 Protein (Fc Tag)
PDMR100072-02 100 µg

Recombinant Rat Fas/TNFRSF6/CD95 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat Fas/TNFRSF6/CD95 Protein (Fc Tag)
PDMR100072-03 500 µg

Recombinant Rat Fas/TNFRSF6/CD95 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat Fas/TNFRSF6/CD95 Protein (Fc Tag)
PDMR100072-04 1 mg

Recombinant Rat Fas/TNFRSF6/CD95 Protein (Fc Tag)

Sign In for Pricing
View Details
RPS28 Human Gene Knockout Kit (CRISPR)
KN422795 1 Kit

RPS28 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details