Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Motility protein A (motA)

This Recombinant Motility protein A (motA) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Motility protein A, Chemotaxis protein MotA

UniProt

Q56331

Expression Region

1-259

Origin

Treponema phagedenis

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLASFIGFFGAFAIILMGGILGGSASGFFHLPSVFITVGGSYLTLFLAYPLSYTLGIFK VCARVFKSADFHEKEIVQRLYALAEKSRRTGLLALEEEIQDFDDEFMRTGLRNVVDGIDG EAIRNLMENELSHMEERHNRWISFINAWATLAPGYGMLGTVMGLIGMLMALEDKSSLGQN MAVALVTTLYGSLMANWLLIPMATKLGLQHEAEVKSKEMIIEGVLAIQAGDHPRILAQRL LVYLNPKDKRELEAELIKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human VSTM2A Protein (His Tag)
PKSH033223-01 10 µg

Recombinant Human VSTM2A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human VSTM2A Protein (His Tag)
PKSH033223-02 50 µg

Recombinant Human VSTM2A Protein (His Tag)

Sign In for Pricing
View Details
TrkA (NTRK1) Rabbit Polyclonal Antibody
AP09509PU-S 50 µL

TrkA (NTRK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ACCN5 (ASIC5) activation kit by CRISPRa
GA109990 1 Kit

Human ACCN5 (ASIC5) activation kit by CRISPRa

Sign In for Pricing
View Details
Human C22orf13 (GUCD1) activation kit by CRISPRa
GA113213 1 Kit

Human C22orf13 (GUCD1) activation kit by CRISPRa

Sign In for Pricing
View Details
B7-2 (CD86) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B10]
TA813089BM 100 µL

B7-2 (CD86) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B10]

Sign In for Pricing
View Details