Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aromatoleum aromaticum Cobalamin synthase (cobS)

This Recombinant Aromatoleum aromaticum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q5P2R7

Expression Region

1-259

Origin

Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTMRYQLELFFTALGFFTRLPVPAWVPWSPERLNHAARFFPLVGWVVGAIGAASYLAFV QLLPPALAVLLSMAVTIRATGAFHEDGWADACDGLGGGWDRLQVLTIMKDSRIGSYGTAG LVLMLLAKAAALVELAAHGNLQVALALLAAHPLSRLASTSLIHTMQYVREDESAKSKPLA RRLSATELVVAAVFGLAPLALLAPAEALAALTATAAATLWAARVFARRLGGYTGDCLGAA QQGSELACYLGILAAWNFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MAdCAM-1 Antibody (OTI1A5) - Azide and BSA Free
NBP2-72568 100 µg

Mouse Monoclonal MAdCAM-1 Antibody (OTI1A5) - Azide and BSA Free

Sign In for Pricing
View Details
Rabbit Polyclonal Dengue Virus 2 Envelope Antibody [Alexa Fluor 488]
NBP3-06004AF488 0.1 mL

Rabbit Polyclonal Dengue Virus 2 Envelope Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Human Nitrotyrosine ELISA Kit
QY-E05288 96 Tests

Human Nitrotyrosine ELISA Kit

Sign In for Pricing
View Details
C18:1 Lyso PAF
TCL-00123-01 100 mg

C18:1 Lyso PAF

Sign In for Pricing
View Details
C18:1 Lyso PAF
TCL-00123-02 250 mg

C18:1 Lyso PAF

Sign In for Pricing
View Details
C18:1 Lyso PAF
TCL-00123-03 50 mg

C18:1 Lyso PAF

Sign In for Pricing
View Details