Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aromatoleum aromaticum Cobalamin synthase (cobS)

This Recombinant Aromatoleum aromaticum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q5P2R7

Expression Region

1-259

Origin

Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTMRYQLELFFTALGFFTRLPVPAWVPWSPERLNHAARFFPLVGWVVGAIGAASYLAFV QLLPPALAVLLSMAVTIRATGAFHEDGWADACDGLGGGWDRLQVLTIMKDSRIGSYGTAG LVLMLLAKAAALVELAAHGNLQVALALLAAHPLSRLASTSLIHTMQYVREDESAKSKPLA RRLSATELVVAAVFGLAPLALLAPAEALAALTATAAATLWAARVFARRLGGYTGDCLGAA QQGSELACYLGILAAWNFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3AP1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
36675154 3x 1.0 µg DNA

PIK3AP1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
CEP78 sgRNA CRISPR Lentivector (Human) (Target 1)
K0434102 1.0 µg DNA

CEP78 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
UBE2V1, CT (Ubiquitin-conjugating Enzyme E2 Variant 1, UEV-1, CROC-1, TRAF6-Regulated IKK Activator 1 beta Uev1A, CROC1, UBE2V, UEV1, P/OKcl.19) (Azide free) (HRP) discontinued
U1075-01J-HRP 200 µL

UBE2V1, CT (Ubiquitin-conjugating Enzyme E2 Variant 1, UEV-1, CROC-1, TRAF6-Regulated IKK Activator 1 beta Uev1A, CROC1, UBE2V, UEV1, P/OKcl.19) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
SfsA Antibody
orb832223 2 mg

SfsA Antibody

Sign In for Pricing
View Details
Human GOLM1 Knockout HEK293T cell line
GTR15422699 1 Vial

Human GOLM1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Bovine IgG1 Antibody (FITC)
GWB-BCAF28 1 mg

Bovine IgG1 Antibody (FITC)

Sign In for Pricing
View Details