Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylococcus capsulatus ATP synthase subunit a 1 (atpB1)

This Recombinant Methylococcus capsulatus ATP synthase subunit a 1 (atpB1) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

ATP synthase subunit a 1, ATP synthase F0 sector subunit a 1, F-ATPase subunit 6 1

UniProt

Q60CS0

Expression Region

1-259

Origin

Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATEAHDAGGATGYIVHHLTPLSSGEGFWTLHVDTLFFSVFLGAVFLFFFRKAAEQATAG VPGPFQNFVEMIVEFVDTQVKDSFHGRNALIAPLALSIFAWVFLMNAMDLLPVDLLPDVG KAIGLEYLRVVPSTDLNATFGMSISVFFLIIFYSLKVKGPGHFAMEFLFHPFSHWALVPF NLLLNTVEYLAKPVSLGLRLFGNMYAGELIFILIALLPWWVQPALSFPWAVFHILIITLQ AFIFMVLTIVYLSLAHESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neu4 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6573802 1.0 µg DNA

Neu4 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Mouse Signal transducer CD24 (Cd24), partial
MBS1182288-01 0.05 mg (E-Coli)

Recombinant Mouse Signal transducer CD24 (Cd24), partial

Sign In for Pricing
View Details
Recombinant Mouse Signal transducer CD24 (Cd24), partial
MBS1182288-02 0.2 mg (E-Coli)

Recombinant Mouse Signal transducer CD24 (Cd24), partial

Sign In for Pricing
View Details
Recombinant Mouse Signal transducer CD24 (Cd24), partial
MBS1182288-03 0.5 mg (E-Coli)

Recombinant Mouse Signal transducer CD24 (Cd24), partial

Sign In for Pricing
View Details
Recombinant Mouse Signal transducer CD24 (Cd24), partial
MBS1182288-04 0.05 mg (Baculovirus)

Recombinant Mouse Signal transducer CD24 (Cd24), partial

Sign In for Pricing
View Details
Recombinant Mouse Signal transducer CD24 (Cd24), partial
MBS1182288-05 0.2 mg (Yeast)

Recombinant Mouse Signal transducer CD24 (Cd24), partial

Sign In for Pricing
View Details