Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041 (RT0041)

This Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041 (RT0041) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Probable ABC transporter permease protein RT0041

UniProt

Q68XW4

Expression Region

1-259

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLNIANLVGKHTIKFAQSVGIFALFSFIAISSIIKPPLYLSLIMRQLLFIGFHSLPVVA MTTFFSGAVLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEI ATMKVTEQVDALYTLSTDPIKYLVCPRVIAAIITMPCLVLIGDVIGVMGGYLVGIYKLNF NSTAYLTSTFQYLELIDVISGLVKATVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVN SSILILISNYLITELLFKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Green Fluorescent FAM-FLICA® Caspase-10 (AEVD) Assay Kit
923 100 Tests

Green Fluorescent FAM-FLICA® Caspase-10 (AEVD) Assay Kit

Sign In for Pricing
View Details
PAX6 (PAX6/498), CF488A conjugate, 0.1mg/mL
BNC880498-500 1x 500 µL

PAX6 (PAX6/498), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rpe65 Mouse Gene Knockout Kit (CRISPR)
KN515002 1 Kit

Rpe65 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CUEDC2 (C-term) Rabbit Polyclonal Antibody
AP22985PU-N 50 µg

CUEDC2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Grubbs Catalyst, 2nd Generation
TRC-G789000-500MG 500 mg

Grubbs Catalyst, 2nd Generation

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS709253 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details