Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon alpha-inducible protein 27-like protein 2B (Ifi27l2b)

This Recombinant Mouse Interferon alpha-inducible protein 27-like protein 2B (Ifi27l2b) spans the amino acid sequence from region 25-283.

Product Specifications

Product Name Alternative

Interferon alpha-inducible protein 27-like protein 2B, Interferon-stimulated gene 12 protein B2, ISG12 (b2)

UniProt

Q8VC49

Expression Region

25-283

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVGFTGAGIAAGSIAAKMMSAAAIANGGGIAAGGLVATLQSVGVLGLSTITNIILVAVGT ATGARAEGSMGASREQESGPQDPPQELQEPQEPPSCKKQDLNLGKFVGAAIGGALAVAGA PIALSAVGFTGAGIAAGSIAAKMMSAAAIANGGGIAAGGLVATLQSVGILGLSTSTNIIL GAVGAATGATAAGAMGACREQEPGLQDLQQEPKEPQEPQELQKQQEPQEPQELQKQQETQ ETQETQELQKTQEPPSYEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-500 1x 500 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF488A conjugate, 0.1mg/mL
BNC880597-500 1x 500 µL

Alkaline Phosphatase (ALPL/597), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF488A conjugate, 0.1mg/mL
BNC880512-100 1x 100 µL

CD68 (KP1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details