Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable phospholipid ABC transporter permease protein mlaE (mlaE)

This Recombinant Probable phospholipid ABC transporter permease protein mlaE (mlaE) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Probable phospholipid ABC transporter permease protein mlaE

UniProt

P64608

Expression Region

1-260

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLVRQLYNVGVLSMLIIV VSGVFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEI GLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFVAVGIWGGSLVGVSWKGI DSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGYDAIPTSAGISRATTRTVV HSSLAVLGLDFVLTALMFGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5B2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1517204 1.0 µg DNA

OR5B2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CHAF1A (Chromatin Assembly Factor 1 Subunit A, CAF-1 Subunit A, Chromatin Assembly Factor I p150 Subunit, CAF-I 150kD Subunit, CAF-I p150, hp150, CAF, CAF1P150) (PE)
124921-PE 100 µL

CHAF1A (Chromatin Assembly Factor 1 Subunit A, CAF-1 Subunit A, Chromatin Assembly Factor I p150 Subunit, CAF-I 150kD Subunit, CAF-I p150, hp150, CAF, CAF1P150) (PE)

Sign In for Pricing
View Details
Scp2 AAV siRNA Pooled Vector
43198164 1.0 µg

Scp2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
KLF6 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-1395R-APC-Cy5.5 100 µL

KLF6 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
FOXO3A (Forkhead Box O3, AF6q21, DKFZp781A0677, FKHRL1, FKHRL1P2, FOXO2, FOXO3A, MGC12739, MGC31925) (MaxLight 750)
MBS6238323-01 0.1 mL

FOXO3A (Forkhead Box O3, AF6q21, DKFZp781A0677, FKHRL1, FKHRL1P2, FOXO2, FOXO3A, MGC12739, MGC31925) (MaxLight 750)

Sign In for Pricing
View Details
FOXO3A (Forkhead Box O3, AF6q21, DKFZp781A0677, FKHRL1, FKHRL1P2, FOXO2, FOXO3A, MGC12739, MGC31925) (MaxLight 750)
MBS6238323-02 5x 0.1 mL

FOXO3A (Forkhead Box O3, AF6q21, DKFZp781A0677, FKHRL1, FKHRL1P2, FOXO2, FOXO3A, MGC12739, MGC31925) (MaxLight 750)

Sign In for Pricing
View Details