Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable phospholipid ABC transporter permease protein mlaE (mlaE)

This Recombinant Probable phospholipid ABC transporter permease protein mlaE (mlaE) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Probable phospholipid ABC transporter permease protein mlaE

UniProt

P64608

Expression Region

1-260

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLVRQLYNVGVLSMLIIV VSGVFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEI GLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFVAVGIWGGSLVGVSWKGI DSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGYDAIPTSAGISRATTRTVV HSSLAVLGLDFVLTALMFGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3R5 Mouse Monoclonal Antibody [Clone 6C5]
E45M13479V-2 50 µL

PIK3R5 Mouse Monoclonal Antibody [Clone 6C5]

Sign In for Pricing
View Details
STT3A, Catalytic Subunit of The Oligosaccharyltransferase Complex (STT3A) Antibody
abx238355 100 µg

STT3A, Catalytic Subunit of The Oligosaccharyltransferase Complex (STT3A) Antibody

Sign In for Pricing
View Details
Prune homolog 2/C9orf65 Rabbit Polyclonal Antibody (BF350)
orb2469339 100 µL

Prune homolog 2/C9orf65 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
TBRG4 cDNA Clone
MBS1268510-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TBRG4 cDNA Clone

Sign In for Pricing
View Details
TBRG4 cDNA Clone
MBS1268510-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

TBRG4 cDNA Clone

Sign In for Pricing
View Details
ACE2 Rabbit mAb Antibody
orb3013974 100 µL

ACE2 Rabbit mAb Antibody

Sign In for Pricing
View Details