Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable phospholipid ABC transporter permease protein mlaE (mlaE)

This Recombinant Probable phospholipid ABC transporter permease protein mlaE (mlaE) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Probable phospholipid ABC transporter permease protein mlaE

UniProt

P64609

Expression Region

1-260

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLVRQLYNVGVLSMLIIV VSGVFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEI GLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFVAVGIWGGSLVGVSWKGI DSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGYDAIPTSAGISRATTRTVV HSSLAVLGLDFVLTALMFGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMX1B Antibody
8C10143-AAT 50 µg

LMX1B Antibody

Sign In for Pricing
View Details
AhR Rabbit mAb
C05452-100uL*2 2x 100μL

AhR Rabbit mAb

Sign In for Pricing
View Details
G Protein-Coupled Receptor Class C Group 5 Member C (GPRC5C) Antibody
abx215697-01 50 µg

G Protein-Coupled Receptor Class C Group 5 Member C (GPRC5C) Antibody

Sign In for Pricing
View Details
G Protein-Coupled Receptor Class C Group 5 Member C (GPRC5C) Antibody
abx215697-02 100 µg

G Protein-Coupled Receptor Class C Group 5 Member C (GPRC5C) Antibody

Sign In for Pricing
View Details
INPP5D Over-expression Lysate Product
GWB-5E63F5 0.1 mg

INPP5D Over-expression Lysate Product

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized Rho GTPase-activating protein At5g61530 (At5g61530)
MBS1372001-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Uncharacterized Rho GTPase-activating protein At5g61530 (At5g61530)

Sign In for Pricing
View Details