Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable phospholipid ABC transporter permease protein mlaE (mlaE)

This Recombinant Probable phospholipid ABC transporter permease protein mlaE (mlaE) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Probable phospholipid ABC transporter permease protein mlaE

UniProt

P64609

Expression Region

1-260

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLVRQLYNVGVLSMLIIV VSGVFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEI GLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFVAVGIWGGSLVGVSWKGI DSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGYDAIPTSAGISRATTRTVV HSSLAVLGLDFVLTALMFGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti- CPT1C-specific antibody
FNab01946 100 µg

anti- CPT1C-specific antibody

Sign In for Pricing
View Details
NKX1-1 Antibody (Center)
E45R30865G-1 100 µL

NKX1-1 Antibody (Center)

Sign In for Pricing
View Details
ER Protein 44 Rabbit pAb
orb2708429-01 50 µL

ER Protein 44 Rabbit pAb

Sign In for Pricing
View Details
ER Protein 44 Rabbit pAb
orb2708429-02 100 µL

ER Protein 44 Rabbit pAb

Sign In for Pricing
View Details
CPM (L113) polyclonal antibody
orb644289-01 25 µL

CPM (L113) polyclonal antibody

Sign In for Pricing
View Details
CPM (L113) polyclonal antibody
orb644289-02 50 μL

CPM (L113) polyclonal antibody

Sign In for Pricing
View Details