Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium radiobacter Cobalamin synthase (cobS)

This Recombinant Agrobacterium radiobacter Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B9JG16

Expression Region

1-260

Origin

Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIREYTSDVARAVAFLSRIPVPASFFEGDDGKLARVSRAFPLAGLLIALPAAITFGVLL AFDADPLMAALLALAIQTVTTGALHEDGLSDTADGLGGGKDRDRALAIMKDSRIGTYGAV ALILSFGLRAAALAAIGRGLAPLDAALTIPAAAVLSRGAMVWHWYALPAAKPDGVAASAG KPDYGPMQIALIAALILSAFLLWPSLRLPAFVLCLLVTVVAAFLFTRHVRQRLSGHTGDT IGAAQQICEIAAFCTLAMCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Htr1b (NM_010482) Mouse Tagged Lenti ORF Clone
MR222524L4 10 µg

Htr1b (NM_010482) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Protein S100-B (S100B) Antibody Pair
abx370318-01 5x 96 Tests

Protein S100-B (S100B) Antibody Pair

Sign In for Pricing
View Details
Protein S100-B (S100B) Antibody Pair
abx370318-02 10x 96 Tests

Protein S100-B (S100B) Antibody Pair

Sign In for Pricing
View Details
GDI2 (NM_001115156) Human Over-expression Lysate
E45H02469-2 20 µg

GDI2 (NM_001115156) Human Over-expression Lysate

Sign In for Pricing
View Details
MEF2C Antibody
orb3052927-01 30 µL

MEF2C Antibody

Sign In for Pricing
View Details
MEF2C Antibody
orb3052927-02 50 µL

MEF2C Antibody

Sign In for Pricing
View Details