Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phosphatidate phosphatase PPAPDC1B (Ppapdc1b)

This Recombinant Mouse Phosphatidate phosphatase PPAPDC1B (Ppapdc1b) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Phosphatidate phosphatase PPAPDC1B, EC= 3.1.3.4, Phosphatidic acid phosphatase type 2 domain-containing protein 1B

UniProt

Q3UMZ3

Expression Region

1-260

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTAALGAELGVRVLLFVAFLVTELLPPFQRRIQPEELWLYRNPYVEAEYFPTGRMFVIA FLTPLSLIFLAKFLRKADATDSKQACLAASLALALNGVFTNIIKLIVGRPRPDFFYRCFP DGLAHSDLTCTGDEDVVNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWR LCAFLSPLLFAAVIALSRTCDYKHHWQDVLVGSMIGMTFAYVCYRQYYPPLTDVECHKPF QDKHKLPSSQKPSELHHLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF548 shRNA (h) Lentiviral Particles
sc-97414-V 200 µL

ZNF548 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Ac-YVAD-CHO
A8954-5 5 mg

Ac-YVAD-CHO

Sign In for Pricing
View Details
ORMDL2 CRISPR Knock Out 293T Cell Line (Human)
35744141 1x 10^6 Cells / 1.0 mL

ORMDL2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Integrin beta 3/ITGB3 Rabbit Polyclonal Antibody (Cy3)
orb2577922 100 µg

Integrin beta 3/ITGB3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Rabbit Polyclonal HPF1 Antibody
NBP2-83060-0.1mL 0.1 mL

Rabbit Polyclonal HPF1 Antibody

Sign In for Pricing
View Details
CDKN2B / p15 INK4b Rabbit Polyclonal Antibody (Cy5.5)
orb1075057 100 µL

CDKN2B / p15 INK4b Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details