Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phosphatidate phosphatase PPAPDC1B (Ppapdc1b)

This Recombinant Mouse Phosphatidate phosphatase PPAPDC1B (Ppapdc1b) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Phosphatidate phosphatase PPAPDC1B, EC= 3.1.3.4, Phosphatidic acid phosphatase type 2 domain-containing protein 1B

UniProt

Q3UMZ3

Expression Region

1-260

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTAALGAELGVRVLLFVAFLVTELLPPFQRRIQPEELWLYRNPYVEAEYFPTGRMFVIA FLTPLSLIFLAKFLRKADATDSKQACLAASLALALNGVFTNIIKLIVGRPRPDFFYRCFP DGLAHSDLTCTGDEDVVNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWR LCAFLSPLLFAAVIALSRTCDYKHHWQDVLVGSMIGMTFAYVCYRQYYPPLTDVECHKPF QDKHKLPSSQKPSELHHLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pAV-U6+27-Tornado-F30-TAR Variant-1 Plasmid
PVT48411 2 µg

pAV-U6+27-Tornado-F30-TAR Variant-1 Plasmid

Sign In for Pricing
View Details
H-Glu (D-Glu-OH) -OH
FG108332-01 500 mg

H-Glu (D-Glu-OH) -OH

Sign In for Pricing
View Details
H-Glu (D-Glu-OH) -OH
FG108332-02 1000 mg

H-Glu (D-Glu-OH) -OH

Sign In for Pricing
View Details
H-Glu (D-Glu-OH) -OH
FG108332-03 2000 mg

H-Glu (D-Glu-OH) -OH

Sign In for Pricing
View Details
Mouse Monoclonal KIR/CD158 Antibody (NKVFS1) [DyLight 405]
NB100-63267V 0.1 mL

Mouse Monoclonal KIR/CD158 Antibody (NKVFS1) [DyLight 405]

Sign In for Pricing
View Details
RQCD1 Lentiviral Activation Particles (m2)
sc-425474-LAC-2 200 µL

RQCD1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details