Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 1 (yidC1)

This Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 19-278.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q5HLG6

Expression Region

19-278

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKEENQTGIFYNVFVKSMDGFLHFLGRVFQDNYGFAIISIVLIVRFILLPFMLIQVK NMHMMREKTKVVQPELDAIRDKMKHATSQEERNAANQLLMKKYQSYGINPLKNMLGCLPV LIQMPILMGLYMSLKYPSSHGITEYPHFLWFDLTQPDLIMTIIAAIMYFVQPLVNSIHYP KDQRKTYYFMMVFSPIFITYASLHSAAALGLYWSISAAFLIVQMHFAHSHYKKVALHEAK KLKQKLEQNKDNSELLTEES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucocorticoid Receptor (NR3C1) Rabbit Polyclonal Antibody
TA379297 100 µL

Glucocorticoid Receptor (NR3C1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-O-Coumaroylquinic Acid
TRC-C899975-50MG 50 mg

5-O-Coumaroylquinic Acid

Sign In for Pricing
View Details
DNAJC15 Recombinant Rabbit Monoclonal Antibody [SY26-04]
ET1607-52 100 µL

DNAJC15 Recombinant Rabbit Monoclonal Antibody [SY26-04]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS627274 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Chloro- (2'-chloro) trityl Polystyrene
H12516033.5G 5 g

Chloro- (2'-chloro) trityl Polystyrene

Sign In for Pricing
View Details
C13orf30 (FAM216B) (NM_182508) Human Recombinant Protein
TP760582 50 µg

C13orf30 (FAM216B) (NM_182508) Human Recombinant Protein

Sign In for Pricing
View Details