Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 1 (yidC1)

This Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 19-278.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q5HLG6

Expression Region

19-278

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKEENQTGIFYNVFVKSMDGFLHFLGRVFQDNYGFAIISIVLIVRFILLPFMLIQVK NMHMMREKTKVVQPELDAIRDKMKHATSQEERNAANQLLMKKYQSYGINPLKNMLGCLPV LIQMPILMGLYMSLKYPSSHGITEYPHFLWFDLTQPDLIMTIIAAIMYFVQPLVNSIHYP KDQRKTYYFMMVFSPIFITYASLHSAAALGLYWSISAAFLIVQMHFAHSHYKKVALHEAK KLKQKLEQNKDNSELLTEES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD244 Antibody
KC-8267-01 50 μL

CD244 Antibody

Sign In for Pricing
View Details
CD244 Antibody
KC-8267-02 100 µL

CD244 Antibody

Sign In for Pricing
View Details
CD244 Antibody
KC-8267-03 1 mL

CD244 Antibody

Sign In for Pricing
View Details
WDPCP (C-term) Rabbit Polyclonal Antibody
AP50739PU-N 400 µL

WDPCP (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human HER4/ErbB4 Protein (His Tag)
PKSH033544-01 10 µg

Recombinant Human HER4/ErbB4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HER4/ErbB4 Protein (His Tag)
PKSH033544-02 50 µg

Recombinant Human HER4/ErbB4 Protein (His Tag)

Sign In for Pricing
View Details