Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 1 (yidC1)

This Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 19-278.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q5HLG6

Expression Region

19-278

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKEENQTGIFYNVFVKSMDGFLHFLGRVFQDNYGFAIISIVLIVRFILLPFMLIQVK NMHMMREKTKVVQPELDAIRDKMKHATSQEERNAANQLLMKKYQSYGINPLKNMLGCLPV LIQMPILMGLYMSLKYPSSHGITEYPHFLWFDLTQPDLIMTIIAAIMYFVQPLVNSIHYP KDQRKTYYFMMVFSPIFITYASLHSAAALGLYWSISAAFLIVQMHFAHSHYKKVALHEAK KLKQKLEQNKDNSELLTEES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]
E-AB-F1016F-01 20 Tests

PerCP Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]

Sign In for Pricing
View Details
PerCP Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]
E-AB-F1016F-02 100 Tests

PerCP Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]

Sign In for Pricing
View Details
PerCP Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]
E-AB-F1016F-03 2x 100 Tests

PerCP Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]

Sign In for Pricing
View Details
Cathepsin L (CTSL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D5]
TA812847BM 100 µL

Cathepsin L (CTSL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D5]

Sign In for Pricing
View Details
FITC Anti-Mouse CD73 Antibody
RD21003F-01 25 µg

FITC Anti-Mouse CD73 Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD73 Antibody
RD21003F-02 100 µg

FITC Anti-Mouse CD73 Antibody

Sign In for Pricing
View Details