Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 2 (yidC2)

This Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 19-278.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8CMK4

Expression Region

19-278

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKEENQTGIFYNVFVKSMDGFLHFLGRVFQDNYGFAIISIVLIVRFILLPFMLIQVK NMHMMREKTKVVQPELDAIRDKMKHATSQEERNAANQLLMKKYQSYGINPLKNMLGCLPV LIQMPILMGLYMSLKYPSSHGITEYPHFLWFDLTQPDLIMTIIAAIMYFVQPLVNSIHYP KDQRKTYYFMMVFSPIFITYASLHSAAALGLYWSISAAFLIVQMHFAHSHYKKVALHEAK KLKQKLEQNKDNSELLTEES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary: right
CB505633 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details
RAP1GDS1 (NM_001100427) Human Recombinant Protein
TP312781 20 µg

RAP1GDS1 (NM_001100427) Human Recombinant Protein

Sign In for Pricing
View Details
SPAG4 Mouse Monoclonal Antibody [Clone ID: OTI3E9]
CF809875 100 µg

SPAG4 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

Sign In for Pricing
View Details
Cell Ferrous Iron Colorimetric Assay Kit
E-BC-K881-M-01 48 T (16 samples)

Cell Ferrous Iron Colorimetric Assay Kit

Sign In for Pricing
View Details
Cell Ferrous Iron Colorimetric Assay Kit
E-BC-K881-M-02 96 T (40 samples)

Cell Ferrous Iron Colorimetric Assay Kit

Sign In for Pricing
View Details
SH-PTP2 Antibody
8C0321-AAT 50 µg

SH-PTP2 Antibody

Sign In for Pricing
View Details