Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Voltage-dependent calcium channel gamma-6 subunit (Cacng6)

This Recombinant Mouse Voltage-dependent calcium channel gamma-6 subunit (Cacng6) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Voltage-dependent calcium channel gamma-6 subunit, Neuronal voltage-gated calcium channel gamma-6 subunit

UniProt

Q8VHW3

Expression Region

1-260

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMWSNFFMQEEDRRRTAVGRRRAQEQQNLGLTPEREGKIKLGLLVAIVGATLAVLAVGTE FWVELNTYKTNGSAVCEAAHLGLWKVCIKRLWQADVPAGRETCGPAELPGEANCTYFKFF TTGENARIFQRTTKKEVNLAAAVIAVLGLTAMALGCLCVIMVLSKGAESLLRLGAVCFGL SGLLLFVSLEVFRHSVGALLQGVNPETPPAPRLAYEYSWSLGCGVGAGLILLLGGVCFLL LTLPSWPWRSLCPKWGGPTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-100 1x 100 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-100 1x 100 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-100 1x 100 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF568 conjugate, 0.1mg/mL
BNC681867-500 1x 500 µL

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details