Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit a (atpB)

This Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A0KQY4

Expression Region

1-260

Origin

Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSATGEVLTPQGYISHHLTHLQVGSGFWTVNIDSMIFSVLLGALFIWSFRRVAVKATSGV PGKLQCFVEMLVEFVSGNVKDIFHGRNKVIAPLGLTVFVWIFLMNLMDLIPVDFIPHAAQ LMGVPYLRVVPSADVNITMSMALGVFFLILYYSIKVKGIGGFVKELTLQPFNHPAAIPVN LILETVTLISKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILSVPWAIFHILIITLQ AFIFMVLTIVYLSMAQEDHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF568 conjugate, 0.1mg/mL
BNC682383-500 1x 500 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), CF555 conjugate, 0.1mg/mL
BNC550809-100 1x 100 µL

Cyclin D1 (CCND1/809), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF647 conjugate, 0.1mg/mL
BNC470287-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2478), CF640R conjugate, 0.1mg/mL
BNC402478-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2478), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), CF647 conjugate, 0.1mg/mL
BNC470315-500 1x 500 µL

Heparan Sulphate Proteoglycan (A7L6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details