Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ginkgo biloba Chloroplast envelope membrane protein (cemA)

This Recombinant Ginkgo biloba Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q4FGG9

Expression Region

1-261

Origin

Ginkgo biloba (Ginkgo) (Maidenhair tree)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPIPRSITRTLSRFRTELTSESSPLVIHELKVAKYKVSASLQYLAFLVFLPWGISISFQ EGLGPWVTNWWNTGQSKIFFSYLQEENALERFGEIEELFLLERMVEDSSETHSQDLRIEI HRKTIQLVKMYNKDCIQIISHLLTNMICFAISSAYFIMSKKKLTVLNSWIQELFYSLSDT MKAFSIISVTDLCIGFHSTHGWELMIDSISENYGFVHNEQIISGLVPTFPVISDTIFKYW IFRHFNRISPPLVVIYHSMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-100 1x 100 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-500 1x 500 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF488A conjugate, 0.1mg/mL
BNC882035-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF488A conjugate, 0.1mg/mL
BNC882400-500 1x 500 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL
BNC470774-500 1x 500 µL

HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details