Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysosomal-associated transmembrane protein 5 (Laptm5)

This Recombinant Mouse Lysosomal-associated transmembrane protein 5 (Laptm5) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 5, Lysosomal-associated multitransmembrane protein 5, Retinoic acid-inducible E3 protein

UniProt

Q61168

Expression Region

1-261

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRM ADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAY LKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPH SQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEE ALSLPPKTPEGDPAPPPYSEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Haze Meter BMET-1204
BMET-1204 1 Unit

Haze Meter BMET-1204

Sign In for Pricing
View Details
Tissue Total RNA, Colon: sigmoid
CR561851 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
Tns2 Mouse Gene Knockout Kit (CRISPR)
KN517405 1 Kit

Tns2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NIF3L1 Polyclonal Antibody
E-AB-10783-01 20 µL

NIF3L1 Polyclonal Antibody

Sign In for Pricing
View Details
NIF3L1 Polyclonal Antibody
E-AB-10783-02 60 µL

NIF3L1 Polyclonal Antibody

Sign In for Pricing
View Details
NIF3L1 Polyclonal Antibody
E-AB-10783-03 120 µL

NIF3L1 Polyclonal Antibody

Sign In for Pricing
View Details