Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysosomal-associated transmembrane protein 5 (Laptm5)

This Recombinant Mouse Lysosomal-associated transmembrane protein 5 (Laptm5) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 5, Lysosomal-associated multitransmembrane protein 5, Retinoic acid-inducible E3 protein

UniProt

Q61168

Expression Region

1-261

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRM ADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAY LKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPH SQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEE ALSLPPKTPEGDPAPPPYSEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypan Blue Monoazo Impurity Sodium Salt
TRC-T223890-25MG 25 mg

Trypan Blue Monoazo Impurity Sodium Salt

Sign In for Pricing
View Details
Polyethylenimine
TRC-P926975-50ML 50 mL

Polyethylenimine

Sign In for Pricing
View Details
Mouse Cstb activation kit by CRISPRa
GA200938 1 Kit

Mouse Cstb activation kit by CRISPRa

Sign In for Pricing
View Details
TMCO5B (C-term) Rabbit Polyclonal Antibody
AP54283PU-N 400 µL

TMCO5B (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thrombopoietin (THPO) (NM_000460) Human Over-expression Lysate
LY424704 100 µg

Thrombopoietin (THPO) (NM_000460) Human Over-expression Lysate

Sign In for Pricing
View Details
Rpl27a (NM_011975) Mouse Tagged ORF Clone
MG201017 10 µg

Rpl27a (NM_011975) Mouse Tagged ORF Clone

Sign In for Pricing
View Details