Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Rhomboid protein 2 (RBD2)

This Recombinant Ashbya gossypii Rhomboid protein 2 (RBD2) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Rhomboid protein 2, EC= 3.4.21.-

UniProt

Q755H8

Expression Region

1-261

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWKSMLRTGVHKPGALTAGLSVFLTLVYVLNWVFPINEKILLDPGALRKLQLTRLSLYP LAHLSIFHLLLNLMSLFVPLSMFEASHGTVFTGITLNLLAIVTGVVYCLVGMLLYPNVYV GGASGWCFTLCGYFAVQEAGFRPHYELASLKMPTLYIPLVFLVLVTLLMPGSSFVGHLIG LGLGYLIGFRERWLQMATPPGWLIVKIETWLDRWISMIPSVVKYHRESSVDRTAGYTPLY QESELPLHNDNFPGQGRVLGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Euonymus europaeus Lectin (Spindle Tree) -EEA-
BA-4201-2 2 mg

Biotin Conjugated Euonymus europaeus Lectin (Spindle Tree) -EEA-

Sign In for Pricing
View Details
c Abl (ABL1) Rabbit Polyclonal Antibody
AP20540PU-N 100 µg

c Abl (ABL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL1RA (IL1RN) (NM_000577) Human Over-expression Lysate
LY424628 100 µg

IL1RA (IL1RN) (NM_000577) Human Over-expression Lysate

Sign In for Pricing
View Details
2'-2'-Chloro-2-phenylacetophenone
TRC-C386038-500MG 500 mg

2'-2'-Chloro-2-phenylacetophenone

Sign In for Pricing
View Details
Cenpu Mouse Gene Knockout Kit (CRISPR)
KN503140 1 Kit

Cenpu Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P53 (Tumor Suppressor Protein) (TP53/2719), CF640R conjugate, 0.1mg/mL
BNC402719-500 1x 500 µL

P53 (Tumor Suppressor Protein) (TP53/2719), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details