Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Rhomboid protein 2 (RBD2)

This Recombinant Ashbya gossypii Rhomboid protein 2 (RBD2) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Rhomboid protein 2, EC= 3.4.21.-

UniProt

Q755H8

Expression Region

1-261

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWKSMLRTGVHKPGALTAGLSVFLTLVYVLNWVFPINEKILLDPGALRKLQLTRLSLYP LAHLSIFHLLLNLMSLFVPLSMFEASHGTVFTGITLNLLAIVTGVVYCLVGMLLYPNVYV GGASGWCFTLCGYFAVQEAGFRPHYELASLKMPTLYIPLVFLVLVTLLMPGSSFVGHLIG LGLGYLIGFRERWLQMATPPGWLIVKIETWLDRWISMIPSVVKYHRESSVDRTAGYTPLY QESELPLHNDNFPGQGRVLGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOR3A Human Gene Knockout Kit (CRISPR)
KN200896RB 1 Kit

TOR3A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS716174 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/1711), CF647 conjugate, 0.1mg/mL
BNC471711-500 1x 500 µL

Desmin (Muscle Cell Marker) (DES/1711), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS640089 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Calpain 1 (CAPN1/1530), 0.2mg/mL
BNUB1530-100 1x 100 µL

Calpain 1 (CAPN1/1530), 0.2mg/mL

Sign In for Pricing
View Details
Phytane
TRC-P399005-50MG 50 mg

Phytane

Sign In for Pricing
View Details