Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Rhomboid protein 2 (RBD2)

This Recombinant Ashbya gossypii Rhomboid protein 2 (RBD2) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Rhomboid protein 2, EC= 3.4.21.-

UniProt

Q755H8

Expression Region

1-261

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWKSMLRTGVHKPGALTAGLSVFLTLVYVLNWVFPINEKILLDPGALRKLQLTRLSLYP LAHLSIFHLLLNLMSLFVPLSMFEASHGTVFTGITLNLLAIVTGVVYCLVGMLLYPNVYV GGASGWCFTLCGYFAVQEAGFRPHYELASLKMPTLYIPLVFLVLVTLLMPGSSFVGHLIG LGLGYLIGFRERWLQMATPPGWLIVKIETWLDRWISMIPSVVKYHRESSVDRTAGYTPLY QESELPLHNDNFPGQGRVLGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zbtb18 Mouse Gene Knockout Kit (CRISPR)
KN519596 1 Kit

Zbtb18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS803181 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Tmc4 Mouse Gene Knockout Kit (CRISPR)
KN517661 1 Kit

Tmc4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPS18 Human Gene Knockout Kit (CRISPR)
KN419170 1 Kit

RPS18 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF488A conjugate, 0.1mg/mL
BNC881986-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acetyl-CoA Carboxylase (Ab-80) Antibody
8B0051-AAT 50 µg

Acetyl-CoA Carboxylase (Ab-80) Antibody

Sign In for Pricing
View Details