Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction beta-6 protein (Gjb6)

This Recombinant Mouse Gap junction beta-6 protein (Gjb6) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Gap junction beta-6 protein, Connexin-30, Cx30

UniProt

P70689

Expression Region

1-261

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWGTLHTVIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGC KNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETARKFIRGEKRNEFKDLED IKRQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDC FISRPTEKTVFTVFMISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESK QNEMNELISDSGQNAITSFPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cfap52 Mouse Gene Knockout Kit (CRISPR)
KN519339 1 Kit

Cfap52 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FXYD1 (NM_005031) Human Recombinant Protein
TP307475 20 µg

FXYD1 (NM_005031) Human Recombinant Protein

Sign In for Pricing
View Details
CHCHD5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G6]
TA502373AM 100 µL

CHCHD5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G6]

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF488A conjugate, 0.1mg/mL
BNC882075-500 1x 500 µL

MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RBIS (NM_001099671) Human Over-expression Lysate
LC420485 20 µg

RBIS (NM_001099671) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIB1 Rabbit Polyclonal Antibody
TA367330 100 µL

TRIB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details