Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction beta-6 protein (Gjb6)

This Recombinant Mouse Gap junction beta-6 protein (Gjb6) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Gap junction beta-6 protein, Connexin-30, Cx30

UniProt

P70689

Expression Region

1-261

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWGTLHTVIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGC KNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETARKFIRGEKRNEFKDLED IKRQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDC FISRPTEKTVFTVFMISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESK QNEMNELISDSGQNAITSFPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5031410I06Rik Mouse Gene Knockout Kit (CRISPR)
KN500462 1 Kit

5031410I06Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/1210), CF594 conjugate, 0.1mg/mL
BNC941210-100 1x 100 µL

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF405S conjugate, 0.1mg/mL
BNC042289-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp541 Mouse Gene Knockout Kit (CRISPR)
KN519876 1 Kit

Zfp541 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC6A12 Human Gene Knockout Kit (CRISPR)
KN422855 1 Kit

SLC6A12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EFCAB2 Human Gene Knockout Kit (CRISPR)
KN402779 1 Kit

EFCAB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details