Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptophysin-like protein 1 (Sypl1)

This Recombinant Mouse Synaptophysin-like protein 1 (Sypl1) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Synaptophysin-like protein 1, Pantophysin

UniProt

O09117

Expression Region

1-261

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASKANMVRQRFSRLSQRMSAFQINLNPLKEPLGFIKILEWFASIFAFATCGGFKGKTEI QVNCPKVGVNKNQTVTATFGYPFRLNQASFHTPPNVSVCDVNWEKHVLIGDYSSSAQFYV TFAVFVFLYCIAALLLYVGYTNLYRDSRKLPMIDFIVTLVATFLWLVSSSAWAKALTDIK VATGHRIVEELEICNPESGVSCYFVSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSL HSPSNTSASHSQGGGPPTSGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IGFBP5, Tag Free
HA211201-01 20 µg

Mouse IGFBP5, Tag Free

Sign In for Pricing
View Details
Mouse IGFBP5, Tag Free
HA211201-02 50 µg

Mouse IGFBP5, Tag Free

Sign In for Pricing
View Details
Mouse IGFBP5, Tag Free
HA211201-03 100 µg

Mouse IGFBP5, Tag Free

Sign In for Pricing
View Details
Isobornyl Acrylate
TRC-I779128-500MG 500 mg

Isobornyl Acrylate

Sign In for Pricing
View Details
Vinylcyclohexane (Stabilized by TBC)
TRC-V757080-250MG 250 mg

Vinylcyclohexane (Stabilized by TBC)

Sign In for Pricing
View Details
GADD45G Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H10]
TA505480AM 100 µL

GADD45G Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H10]

Sign In for Pricing
View Details