Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptophysin-like protein 1 (Sypl1)

This Recombinant Mouse Synaptophysin-like protein 1 (Sypl1) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Synaptophysin-like protein 1, Pantophysin

UniProt

O09117

Expression Region

1-261

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASKANMVRQRFSRLSQRMSAFQINLNPLKEPLGFIKILEWFASIFAFATCGGFKGKTEI QVNCPKVGVNKNQTVTATFGYPFRLNQASFHTPPNVSVCDVNWEKHVLIGDYSSSAQFYV TFAVFVFLYCIAALLLYVGYTNLYRDSRKLPMIDFIVTLVATFLWLVSSSAWAKALTDIK VATGHRIVEELEICNPESGVSCYFVSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSL HSPSNTSASHSQGGGPPTSGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC II, Mouse (MK-D6), CF647 conjugate, 0.1mg/mL
BNC472007-500 1x 500 µL

MHC II, Mouse (MK-D6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS509733 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Clathrin light chain (CLTA) Rabbit Polyclonal Antibody
TA374898 100 µL

Clathrin light chain (CLTA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UGT1A5 Human Gene Knockout Kit (CRISPR)
KN421373 1 Kit

UGT1A5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Octadecanoyl Isopropylidene Glycerol-d5
TRC-O235587-5MG 5 mg

Octadecanoyl Isopropylidene Glycerol-d5

Sign In for Pricing
View Details
(4R)-5-(3',4'-Dihydroxyphenyl)-gamma-valerolactone-d3 ((-)-Epicatechin Metabolite)
TRC-D454527-10MG 10 mg

(4R)-5-(3',4'-Dihydroxyphenyl)-gamma-valerolactone-d3 ((-)-Epicatechin Metabolite)

Sign In for Pricing
View Details