Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction beta-6 protein (GJB6)

This Recombinant Human Gap junction beta-6 protein (GJB6) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Gap junction beta-6 protein, Connexin-30, Cx30

UniProt

O95452

Expression Region

1-261

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWGTLHTFIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGC KNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETTRKFRRGEKRNDFKDIED IKKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDC FISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESK QNEMNELISDSGQNAITGFPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(5Alpha)-Estrane-3,17-dione-d6
TRC-E668422-5MG 5 mg

(5Alpha)-Estrane-3,17-dione-d6

Sign In for Pricing
View Details
H3C1 Rabbit Monoclonal Antibody [Clone ID: 23GB4480]
TA424859 100 µL

H3C1 Rabbit Monoclonal Antibody [Clone ID: 23GB4480]

Sign In for Pricing
View Details
Abcg5 Mouse Gene Knockout Kit (CRISPR)
KN500643 1 Kit

Abcg5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(E)-4,4'-(Hex-3-ene-3,4-diyl-1,1,1,6,6,6-d6)diphenol
TRC-H283499-10MG 10 mg

(E)-4,4'-(Hex-3-ene-3,4-diyl-1,1,1,6,6,6-d6)diphenol

Sign In for Pricing
View Details
TMRE, 2 mM solution in DMSO
#70005 1x 500 µL

TMRE, 2 mM solution in DMSO

Sign In for Pricing
View Details
Human Protein Disulfide Isomerase A6 (PDIA6) ELISA Kit
RDR-PDIA6-Hu-01 96 Tests

Human Protein Disulfide Isomerase A6 (PDIA6) ELISA Kit

Sign In for Pricing
View Details