Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction beta-6 protein (GJB6)

This Recombinant Human Gap junction beta-6 protein (GJB6) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Gap junction beta-6 protein, Connexin-30, Cx30

UniProt

O95452

Expression Region

1-261

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWGTLHTFIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGC KNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETTRKFRRGEKRNDFKDIED IKKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDC FISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESK QNEMNELISDSGQNAITGFPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SOX18 Antibody
RC-15401-01 50 μL

Recombinant SOX18 Antibody

Sign In for Pricing
View Details
Recombinant SOX18 Antibody
RC-15401-02 100 µL

Recombinant SOX18 Antibody

Sign In for Pricing
View Details
Recombinant SOX18 Antibody
RC-15401-03 1 mL

Recombinant SOX18 Antibody

Sign In for Pricing
View Details
GNAT3 (NM_001102386) Human Over-expression Lysate
LY420138 100 µg

GNAT3 (NM_001102386) Human Over-expression Lysate

Sign In for Pricing
View Details
ERGIC1 (NM_001031711) Human Over-expression Lysate
LY422162 100 µg

ERGIC1 (NM_001031711) Human Over-expression Lysate

Sign In for Pricing
View Details
KAT8 (C-term) Rabbit Polyclonal Antibody
AP11149PU-N 400 µL

KAT8 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details