Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus succinogenes ATP synthase subunit a (atpB)

This Recombinant Actinobacillus succinogenes ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A6VL63

Expression Region

1-261

Origin

Actinobacillus succinogenes (strain ATCC 55618 / 130Z)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGTTAGYIGHHLTFLSSGEGFWAVHLDTLFFSIVSALIFLFVFRNVAKKATSGVPGKLQ CMVEIVVEWINGIVKENFHGPRNVVAPLALTIFCWVFIMNAIDLIPVDFLPQLAGLFGIH YLRAVPTADISATLGMSLCVFALILFYTVKSKGFGGLVKEYTLHPFNHWTLVPVNFILET VTLLAKPISLAFRLFGNMYAGELIFILIAVMYSANAAIAALGIPLHLAWAIFHILIITLQ AFIFMMLTVVYLSIAYNKAEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 405 hydrazide
1081-AAT 1 mg

IFluor® 405 hydrazide

Sign In for Pricing
View Details
2-Hydrazinylbenzoic Acid
TRC-H614480-50MG 50 mg

2-Hydrazinylbenzoic Acid

Sign In for Pricing
View Details
Recombinant PDPK1 Antibody
RC-15472-01 50 μL

Recombinant PDPK1 Antibody

Sign In for Pricing
View Details
Recombinant PDPK1 Antibody
RC-15472-02 100 µL

Recombinant PDPK1 Antibody

Sign In for Pricing
View Details
Recombinant PDPK1 Antibody
RC-15472-03 1 mL

Recombinant PDPK1 Antibody

Sign In for Pricing
View Details
Cephapirin
TRC-C261500-25MG 25 mg

Cephapirin

Sign In for Pricing
View Details