Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus succinogenes ATP synthase subunit a (atpB)

This Recombinant Actinobacillus succinogenes ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A6VL63

Expression Region

1-261

Origin

Actinobacillus succinogenes (strain ATCC 55618 / 130Z)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGTTAGYIGHHLTFLSSGEGFWAVHLDTLFFSIVSALIFLFVFRNVAKKATSGVPGKLQ CMVEIVVEWINGIVKENFHGPRNVVAPLALTIFCWVFIMNAIDLIPVDFLPQLAGLFGIH YLRAVPTADISATLGMSLCVFALILFYTVKSKGFGGLVKEYTLHPFNHWTLVPVNFILET VTLLAKPISLAFRLFGNMYAGELIFILIAVMYSANAAIAALGIPLHLAWAIFHILIITLQ AFIFMMLTVVYLSIAYNKAEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon: sigmoid
CR561633 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
CF®640R dCTP, Lyophilized powder
#40066-T 1x 5 nmol

CF®640R dCTP, Lyophilized powder

Sign In for Pricing
View Details
PMS1 (NM_000534) Human Over-expression Lysate
LC424657 20 µg

PMS1 (NM_000534) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CCDC148 activation kit by CRISPRa
GA115132 1 Kit

Human CCDC148 activation kit by CRISPRa

Sign In for Pricing
View Details
PDLIM2 (NM_176871) Human Recombinant Protein
TP319644L 1 mg

PDLIM2 (NM_176871) Human Recombinant Protein

Sign In for Pricing
View Details
GAGE12F Rabbit Polyclonal Antibody
TA371353 100 µL

GAGE12F Rabbit Polyclonal Antibody

Sign In for Pricing
View Details