Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sinorhizobium medicae Cobalamin synthase (cobS)

This Recombinant Sinorhizobium medicae Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A6U9W5

Expression Region

1-262

Origin

Sinorhizobium medicae (strain WSM419) (Ensifer medicae)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEIREFWDDVARSVAFLSRIPVPDRHFRGHDGGLGRAVRAFPLAGILIALPAAVTAVLL GAIHASSLFTAFLIVAAQATVTGALHEDGLADTADGFGGGRDRESALEIMKDSRIGTYGA VALILSFGIRVSALAAFLPLLTPTGGGVALLATAALSRAAMVWHWSRLPPARRDGVAAAA GAPEAPATSVALGSGVILALVLFFLSGIPTVAVLLSFGAFVLAVLSFTRIASRKLGGHTG DTIGATQQLTEVAVLGALALAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propyl Benzoate
TRC-P109295-5G 5 g

Propyl Benzoate

Sign In for Pricing
View Details
DPP1 (CTSC) (NM_001814) Human Over-expression Lysate
LC400694 20 µg

DPP1 (CTSC) (NM_001814) Human Over-expression Lysate

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF594 conjugate, 0.1mg/mL
BNC942430-500 1x 500 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STXBP4 Polyclonal Antibody
E-AB-63225-01 60 µL

STXBP4 Polyclonal Antibody

Sign In for Pricing
View Details
STXBP4 Polyclonal Antibody
E-AB-63225-02 120 µL

STXBP4 Polyclonal Antibody

Sign In for Pricing
View Details
STXBP4 Polyclonal Antibody
E-AB-63225-03 200 µL

STXBP4 Polyclonal Antibody

Sign In for Pricing
View Details