Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Lysosomal-associated transmembrane protein 5 (LAPTM5)

This Recombinant Pongo abelii Lysosomal-associated transmembrane protein 5 (LAPTM5) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 5, Lysosomal-associated multitransmembrane protein 5

UniProt

Q5REZ0

Expression Region

1-262

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPRLSAVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRI ADLISSFLLIAMLFIISLSLLIGVVKNREKYLLPFLSLQVMDYLLCLLTLLGSYIELPAY LKLASRSRASPSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMP HNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRFIKCMNSVEEKRNSKMLQKVVLPSYE EALSLPSKTPEGGPAPPPYSEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPP2R3C activation kit by CRISPRa
GA110451 1 Kit

Human PPP2R3C activation kit by CRISPRa

Sign In for Pricing
View Details
Lamin B Receptor (LBR) Human Gene Knockout Kit (CRISPR)
KN401990 1 Kit

Lamin B Receptor (LBR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(S)-Lercanidipine Hydrochloride
TRC-L179020-50MG 50 mg

(S)-Lercanidipine Hydrochloride

Sign In for Pricing
View Details
Hydroxystilbamidine *CAS 223769-64-0*
17514-AAT 10 mg

Hydroxystilbamidine *CAS 223769-64-0*

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), 1mg/mL
BNUM1782-50 1x 50 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), 1mg/mL

Sign In for Pricing
View Details
Climatic Chamber BCCL-1406
BCCL-1406 1 Unit

Climatic Chamber BCCL-1406

Sign In for Pricing
View Details