Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Lysosomal-associated transmembrane protein 5 (LAPTM5)

This Recombinant Pongo abelii Lysosomal-associated transmembrane protein 5 (LAPTM5) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 5, Lysosomal-associated multitransmembrane protein 5

UniProt

Q5REZ0

Expression Region

1-262

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPRLSAVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRI ADLISSFLLIAMLFIISLSLLIGVVKNREKYLLPFLSLQVMDYLLCLLTLLGSYIELPAY LKLASRSRASPSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMP HNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRFIKCMNSVEEKRNSKMLQKVVLPSYE EALSLPSKTPEGGPAPPPYSEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), 0.2mg/mL
BNUB1856-500 1x 500 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), 0.2mg/mL

Sign In for Pricing
View Details
Eptinezumab Biosimilar - Research Grade
ICH5044-5mg 5 mg

Eptinezumab Biosimilar - Research Grade

Sign In for Pricing
View Details
3-[[(5-Carboxypentyl)amino]carbonyl]-3-hydroxypentanedioic Acid
TRC-C181165-50MG 50 mg

3-[[(5-Carboxypentyl)amino]carbonyl]-3-hydroxypentanedioic Acid

Sign In for Pricing
View Details
DL-3-Aminoisobutyric Acid Hydrate
TRC-A614325-250MG 250 mg

DL-3-Aminoisobutyric Acid Hydrate

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF405S conjugate, 0.1mg/mL
BNC040820-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Microtiter Plates (P96OD)
P96OD 96 Well Tests

Microtiter Plates (P96OD)

Sign In for Pricing
View Details