Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Cobalamin synthase (cobS)

This Recombinant Rhizobium meliloti Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q92P97

Expression Region

1-262

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADIRELWDDVARSVAFLSRIPVPDRYFHGYDGGLGRAVRAFPLAAILITLPAAAIAFIL GALHASSLFSAFLVVAVQAMVTGALHEDGLGDTADGFGGGRDRESALEIMKDSRIGTYGA VALILSFGLRVSALAAFLPLLTPTGGGIALLATAALSRAAMVWHWSRLPPARRGGVAASA GIPEPGATSVALGSGVLLALVLFFLAGIPTVAVWLSFAAFGLAVPGFTRIASRKLGGHTG DTIGATQQLTEVAVLGALALAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS629433 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
O,O,S-Triethyl Phosphorothiolate
TRC-T777015-250MG 250 mg

O,O,S-Triethyl Phosphorothiolate

Sign In for Pricing
View Details
MEK6 (MAP2K6) pSer207 Rabbit Polyclonal Antibody
AP02431PU-S 50 µL

MEK6 (MAP2K6) pSer207 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human LOC647264 activation kit by CRISPRa
GA118804 1 Kit

Human LOC647264 activation kit by CRISPRa

Sign In for Pricing
View Details
Galloflavin
TRC-G190550-10MG 10 mg

Galloflavin

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB605506 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details