Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Cobalamin synthase (cobS)

This Recombinant Rhizobium meliloti Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q92P97

Expression Region

1-262

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADIRELWDDVARSVAFLSRIPVPDRYFHGYDGGLGRAVRAFPLAAILITLPAAAIAFIL GALHASSLFSAFLVVAVQAMVTGALHEDGLGDTADGFGGGRDRESALEIMKDSRIGTYGA VALILSFGLRVSALAAFLPLLTPTGGGIALLATAALSRAAMVWHWSRLPPARRGGVAASA GIPEPGATSVALGSGVLLALVLFFLAGIPTVAVWLSFAAFGLAVPGFTRIASRKLGGHTG DTIGATQQLTEVAVLGALALAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF594 conjugate, 0.1mg/mL
BNC942172-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PI 4 Kinase type 2 beta (PI4K2B) (NM_018323) Human Over-expression Lysate
LY402666 100 µg

PI 4 Kinase type 2 beta (PI4K2B) (NM_018323) Human Over-expression Lysate

Sign In for Pricing
View Details
S100A12 (NM_005621) Human Over-expression Lysate
LY401723 100 µg

S100A12 (NM_005621) Human Over-expression Lysate

Sign In for Pricing
View Details
rac-2,3-Dimercaptosuccinic Acid
TRC-D555620-5MG 5 mg

rac-2,3-Dimercaptosuccinic Acid

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561275 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR561226 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details