Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Cobalamin synthase (cobS)

This Recombinant Rhizobium meliloti Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q92P97

Expression Region

1-262

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADIRELWDDVARSVAFLSRIPVPDRYFHGYDGGLGRAVRAFPLAAILITLPAAAIAFIL GALHASSLFSAFLVVAVQAMVTGALHEDGLGDTADGFGGGRDRESALEIMKDSRIGTYGA VALILSFGLRVSALAAFLPLLTPTGGGIALLATAALSRAAMVWHWSRLPPARRGGVAASA GIPEPGATSVALGSGVLLALVLFFLAGIPTVAVWLSFAAFGLAVPGFTRIASRKLGGHTG DTIGATQQLTEVAVLGALALAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tegoprazan
TRC-T145030-50MG 50 mg

Tegoprazan

Sign In for Pricing
View Details
Neurokinin 1 Receptor (TACR1) (NM_001058) Human Over-expression Lysate
LC420738 20 µg

Neurokinin 1 Receptor (TACR1) (NM_001058) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Pentraxin 3 / PTX3 Recombinant Rabbit monoclonal Antibody
HA723390 100 µL

Human Pentraxin 3 / PTX3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
OX40 / CD134/ TNFRSF4 (Immuno-Oncology Target) (OX40/3108), CF568 conjugate, 0.1mg/mL
BNC683108-100 1x 100 µL

OX40 / CD134/ TNFRSF4 (Immuno-Oncology Target) (OX40/3108), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ERBB4 Antibody
KC-8176-01 50 μL

ERBB4 Antibody

Sign In for Pricing
View Details
ERBB4 Antibody
KC-8176-02 100 µL

ERBB4 Antibody

Sign In for Pricing
View Details