Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Inner membrane protein ycfZ (ycfZ)

This Recombinant Escherichia coli Inner membrane protein ycfZ (ycfZ) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Inner membrane protein ycfZ

UniProt

P75961

Expression Region

1-262

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKFIILLSLLILLPLTAASKPLIPIMKTLFTDVTGTVPDAEEIAHKAELFRQQTGIAPF IVVLPDINNEASLRQNGKAMLAHASSSLSDVKGSVLLLFTTREPRLIMITNGQVESGLDD KHLGLLIENHTLAYLNADLWYQGINNALAVLQAQILKQSTPPLTYYPHPGQQHENAPPGS TNTLGFIAWAATFILFSRIFYYTTRFIYALKFAVAMTIANMGYQALCLYIDNSFAITRIS PLWAGLIGVCTFIAALLLTSKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-100 1x 100 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-500 1x 500 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), CF640R conjugate, 0.1mg/mL
BNC401041-100 1x 100 µL

TRIM29 (TRIM29/1041), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF640R conjugate, 0.1mg/mL
BNC402730-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details