Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

B1YH82

Expression Region

1-263

Origin

Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVGQHIPGTSYLHRSSAVAKIIFAFCFIPLVFLANNAATNIFLLLFTFFALASSKLPIR YVLKGLRPILFLIIFTFIIQLLFTREGAVLFEFGWFKIYEEGLRLAIIVSLRFFYLVSIT TLVTLTTSPIELTDAIELLLKPFKVVRVPTHEIALMLSISLRFLPTLAEETEKIMKAQQA RGVDLSAGPIKERLRAIIPLLIPLFISAFKRAEDLATAMEARGYRGGEGRTRLRESKWTT RDTGLILLLVALGLLLVYLRGGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SIRT7 shRNA (UAS) - Lentiviral human SIRT7 shRNA (UAS, GFP) (25)
GTR15316403 1 Vial

Lentiviral human SIRT7 shRNA (UAS) - Lentiviral human SIRT7 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Phospho-MAK (Tyr159) Rabbit Polyclonal Antibody (PE-Cy7)
orb956848 100 µL

Phospho-MAK (Tyr159) Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
CXCR3 Rabbit pAb
E2510769 100 µL

CXCR3 Rabbit pAb

Sign In for Pricing
View Details
Rat Diablo Homolog (DIABLO) ELISA Kit
EKN49521-01 48 Tests

Rat Diablo Homolog (DIABLO) ELISA Kit

Sign In for Pricing
View Details
Rat Diablo Homolog (DIABLO) ELISA Kit
EKN49521-02 96 Tests

Rat Diablo Homolog (DIABLO) ELISA Kit

Sign In for Pricing
View Details
Rat Diablo Homolog (DIABLO) ELISA Kit
EKN49521-03 5x 96 Tests

Rat Diablo Homolog (DIABLO) ELISA Kit

Sign In for Pricing
View Details