Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

B1YH82

Expression Region

1-263

Origin

Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVGQHIPGTSYLHRSSAVAKIIFAFCFIPLVFLANNAATNIFLLLFTFFALASSKLPIR YVLKGLRPILFLIIFTFIIQLLFTREGAVLFEFGWFKIYEEGLRLAIIVSLRFFYLVSIT TLVTLTTSPIELTDAIELLLKPFKVVRVPTHEIALMLSISLRFLPTLAEETEKIMKAQQA RGVDLSAGPIKERLRAIIPLLIPLFISAFKRAEDLATAMEARGYRGGEGRTRLRESKWTT RDTGLILLLVALGLLLVYLRGGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SHISA9 Antibody [Alexa Fluor 532]
NBP1-76496AF532 0.1 mL

Rabbit Polyclonal SHISA9 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
GPR17 discontinued
536887-01 30ul

GPR17 discontinued

Sign In for Pricing
View Details
GPR17 discontinued
536887-02 100 µL

GPR17 discontinued

Sign In for Pricing
View Details
TSPAN31 Polyclonal Antibody
MBS9432065-01 0.05 mL

TSPAN31 Polyclonal Antibody

Sign In for Pricing
View Details
TSPAN31 Polyclonal Antibody
MBS9432065-02 0.1 mL

TSPAN31 Polyclonal Antibody

Sign In for Pricing
View Details
TSPAN31 Polyclonal Antibody
MBS9432065-03 5x 0.1 mL

TSPAN31 Polyclonal Antibody

Sign In for Pricing
View Details