Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

B1YH82

Expression Region

1-263

Origin

Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVGQHIPGTSYLHRSSAVAKIIFAFCFIPLVFLANNAATNIFLLLFTFFALASSKLPIR YVLKGLRPILFLIIFTFIIQLLFTREGAVLFEFGWFKIYEEGLRLAIIVSLRFFYLVSIT TLVTLTTSPIELTDAIELLLKPFKVVRVPTHEIALMLSISLRFLPTLAEETEKIMKAQQA RGVDLSAGPIKERLRAIIPLLIPLFISAFKRAEDLATAMEARGYRGGEGRTRLRESKWTT RDTGLILLLVALGLLLVYLRGGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOAT Lentiviral Activation Particles (m2)
sc-429251-LAC-2 200 µL

NCOAT Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal FKBP15 Antibody [DyLight 650]
NBP1-77352C 0.1 mL

Rabbit Polyclonal FKBP15 Antibody [DyLight 650]

Sign In for Pricing
View Details
Sheep Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3A (GSPT1) ELISA Kit
MBS9924647-01 48 Well

Sheep Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3A (GSPT1) ELISA Kit

Sign In for Pricing
View Details
Sheep Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3A (GSPT1) ELISA Kit
MBS9924647-02 96 Well

Sheep Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3A (GSPT1) ELISA Kit

Sign In for Pricing
View Details
Sheep Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3A (GSPT1) ELISA Kit
MBS9924647-03 5x 96 Well

Sheep Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3A (GSPT1) ELISA Kit

Sign In for Pricing
View Details
Sheep Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3A (GSPT1) ELISA Kit
MBS9924647-04 10x 96 Well

Sheep Eukaryotic Peptide Chain Release Factor GTP-Binding Subunit ERF3A (GSPT1) ELISA Kit

Sign In for Pricing
View Details